Recombinant Human MXI1 protein, GST-tagged

Cat.No. : MXI1-13H
Product Overview : Recombinant Human MXI1(1 a.a. - 228 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
ProteinLength : 1-228 a.a.
Description : Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 52.5 kDa
AA Sequence : MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNEL EKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGP QEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLS FTS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MXI1 MAX interactor 1 [ Homo sapiens ]
Official Symbol MXI1
Synonyms MXI1; MAX interactor 1; MAX interacting protein 1; max-interacting protein 1; bHLHc11; MAD2; MXD2; MXI; MAX dimerization protein 2; Max-related transcription factor; class C basic helix-loop-helix protein 11; MGC43220;
Gene ID 4601
mRNA Refseq NM_005962
Protein Refseq NP_005953
MIM 600020
UniProt ID P50539
Chromosome Location 10q24-q25
Function DNA binding; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MXI1 Products

Required fields are marked with *

My Review for All MXI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon