Recombinant Human MXD1 protein, GST-tagged

• Cat.No.: MXD1-301546H
• Product Overview: Recombinant Human MXD1 (170-221 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Asp170-Leu221
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: DYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MXD1 MAX dimerization protein 1 [ Homo sapiens ]
• Official Symbol: MXD1
• Synonyms: MXD1; MAX dimerization protein 1; MAD; max dimerization protein 1; bHLHc58; MAD1; max dimerizer 1; MAX-binding protein; antagonizer of myc transcriptional activity; BHLHC58; MGC104659
• Gene ID: 4084
• mRNA Refseq: NM_001202513
• Protein Refseq: NP_001189442
• MIM: 600021
• UniProt ID: Q05195