Recombinant Human MVD, His-tagged
Cat.No. : | MVD-26959TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 25-400 of Human MVD with an N terminal His tag; MWt 55kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 25-400 a.a. |
Description : | The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP. |
Conjugation : | HIS |
Tissue specificity : | Expressed in heart, skeletal muscle, lung, liver, brain, pancreas, kidney and placenta. |
Form : | Lyophilised:Reconstitute with 90 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDR IWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPL PSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLAR VYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADG KDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLT MKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAH HGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPP GSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYI IVTQVGPGPQILDDPCAHLLGPDGLPKPAA |
Sequence Similarities : | Belongs to the diphosphomevalonate decarboxylase family. |
Gene Name | MVD mevalonate (diphospho) decarboxylase [ Homo sapiens ] |
Official Symbol | MVD |
Synonyms | MVD; mevalonate (diphospho) decarboxylase; diphosphomevalonate decarboxylase; mevalonate pyrophosphate decarboxylase; MPD; |
Gene ID | 4597 |
mRNA Refseq | NM_002461 |
Protein Refseq | NP_002452 |
MIM | 603236 |
Uniprot ID | P53602 |
Chromosome Location | 16q24.3 |
Pathway | C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; Hsp70 protein binding; diphosphomevalonate decarboxylase activity; diphosphomevalonate decarboxylase activity; kinase activity; |
◆ Recombinant Proteins | ||
WBSCR28-10115M | Recombinant Mouse WBSCR28 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPA1-694C | Recombinant Cynomolgus Monkey SNRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM109-9279M | Recombinant Mouse TMEM109 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKIRIN2-1486M | Recombinant Mouse AKIRIN2 Protein | +Inquiry |
LDB3-5020M | Recombinant Mouse LDB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
IGHA-209H | Native Human Immunoglobulin A (IgA) | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-835M | Mini pig Spleen Membrane Lysate, Total Protein | +Inquiry |
SULT1C2-1351HCL | Recombinant Human SULT1C2 293 Cell Lysate | +Inquiry |
RNF4-2276HCL | Recombinant Human RNF4 293 Cell Lysate | +Inquiry |
ZNF280C-1721HCL | Recombinant Human ZNF280C cell lysate | +Inquiry |
STK17B-1407HCL | Recombinant Human STK17B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MVD Products
Required fields are marked with *
My Review for All MVD Products
Required fields are marked with *
0
Inquiry Basket