Recombinant Human MUTED Protein, GST-tagged

• Cat.No.: MUTED-5763H
• Product Overview: Human MUTED full-length ORF ( NP_958437.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Some transcripts of the downstream gene TXNDC5 overlap this gene, but they do not contain an open reading frame for this gene. [provided by RefSeq
• Molecular Mass: 48 kDa
• AA Sequence: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MUTED muted homolog (mouse) [ Homo sapiens ]
• Official Symbol: MUTED
• Synonyms: MUTED; muted homolog (mouse); protein Muted homolog; dJ303A1.3; MU; FLJ18427; DKFZp686E2287
• Gene ID: 63915
• mRNA Refseq: NM_001199322
• Protein Refseq: NP_001186251
• MIM: 607289
• UniProt ID: Q8TDH9