Recombinant Human MUC15, His-tagged

• Cat.No.: MUC15-149H
• Product Overview: Recombinant Human Mucin-15/MUC15 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys24-Thr236) of Human MUC15 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• ProteinLength: 24-236 a.a.
• Description: Mucin-15 is a single-pass type I membrane protein member of the Mucin family. Mucins are a family of high molecular weight, heavily glycosylated proteins (glycoconjugates) produced by epithelial tissues in most metazoans. A key characteristic of Mucins is their ability to form gels. Therefore they are a key component in most gel-like secretions, serving functions from lubrication to cell signalling to forming chemical barriers. Mucin-15 is expressed in many tissues. Mucin-15 is highly glycosylated (N- and O-linked carbohydrates). Mucin-15 may play a role in the cell adhesion to the extracellular matrix.
• AA Sequence: KENQDINTTQNIAEVFKTMENKPISLESEANLNSDKENITTSNLKASHSPPLNLPNNSHGITDFS SNSSAEHSLGSLKPTSTISTSPPLIHSFVSKVPWNAPIADEDLLPISAHPNATPALSSENFTWSL VNDTVKTPDNSSITVSILSSEPTSPSVTPLIVEPSGWLTTNSDSFTGFIPYQEKTTLQPTLKFTN NSKLFPNTSDPQKENRNTVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: MUC15 mucin 15, cell surface associated [ Homo sapiens ]
• Official Symbol: MUC15
• Synonyms: MUC15; mucin 15, cell surface associated; mucin-15; PAS3; MUC-15; PASIII
• Gene ID: 143662
• mRNA Refseq: NM_001135091
• Protein Refseq: NP_001128563
• MIM: 608566
• UniProt ID: Q8N387
• Chromosome Location: 11p14.3
• Pathway: Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem