Recombinant Human MTSS1 protein, GST-tagged

• Cat.No.: MTSS1-301382H
• Product Overview: Recombinant Human MTSS1 (345-446 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Pro345-Gly446
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: PGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MTSS1 metastasis suppressor 1 [ Homo sapiens ]
• Official Symbol: MTSS1
• Synonyms: MTSS1; metastasis suppressor 1; metastasis suppressor protein 1; KIAA0429; MIM; MIMA; MIMB; metastasis suppressor YGL-1; missing in metastasis protein; FLJ44694; DKFZp781P2223
• Gene ID: 9788
• mRNA Refseq: NM_014751
• Protein Refseq: NP_055566
• MIM: 608486
• UniProt ID: O43312