Recombinant Human MTRF1 Protein, GST-tagged

Cat.No. : MTRF1-5732H
Product Overview : Human MTRF1 full-length ORF ( ENSP00000239852, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene was determined by in silico methods to be a mitochondrial protein with similarity to the peptide chain release factors (RFs) discovered in bacteria and yeast. The peptide chain release factors direct the termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein synthesis, a recent publication found no mitochondrial translation release functionality. Multiple alternatively spliced transcript variants have been suggested by mRNA and EST data; however, their full-length natures are not clear. [provided by RefSeq
Molecular Mass : 44.6 kDa
AA Sequence : MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTRF1 mitochondrial translational release factor 1 [ Homo sapiens ]
Official Symbol MTRF1
Synonyms MTRF1; mitochondrial translational release factor 1; peptide chain release factor 1, mitochondrial; MGC47721; mitochontrial peptide chain release factor 1; MTTRF1; RF1; MRF-1; mtRF-1; MRF1;
Gene ID 9617
mRNA Refseq NM_004294
Protein Refseq NP_004285
MIM 604601
UniProt ID O75570

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTRF1 Products

Required fields are marked with *

My Review for All MTRF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon