Recombinant Human MTOR protein, His&Myc-tagged

• Cat.No.: MTOR-4396H
• Product Overview: Recombinant Human MTOR protein(P42345)(2012-2144aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.2 kDa
• Protein length: 2012-2144aa
• AA Sequence: VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens ]
• Official Symbol: MTOR
• Synonyms: MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1 , FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506 binding protein 12 rapamycin associated protein 2; FKBP rapamycin associated protein; FKBP12 rapamycin complex associated protein 1; FLJ44809; mammalian target of rapamycin; RAFT1; rapamycin and FKBP12 target 1; rapamycin associated protein FRAP2; rapamycin target protein; RAPT1; rapamycin target protein 1; FKBP-rapamycin associated protein; FKBP12-rapamycin complex-associated protein 1; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FRAP; FRAP1; FRAP2
• Gene ID: 2475
• mRNA Refseq: NM_004958
• Protein Refseq: NP_004949
• MIM: 601231
• UniProt ID: P42345