Recombinant Human MTNR1A

Cat.No. : MTNR1A-30196TH
Product Overview : Recombinant fragment corresponding to amino acids 296-350 of Human Melatonin Receptor 1A with an N terminal proprietary tag; Predicted MWt 31.68 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 55 amino acids
Description : This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin.
Molecular Weight : 31.680kDa inclusive of tags
Tissue specificity : Expressed in hypophyseal pars tuberalis and hypothalamic suprachiasmatic nuclei (SCN). Hippocampus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name MTNR1A melatonin receptor 1A [ Homo sapiens ]
Official Symbol MTNR1A
Synonyms MTNR1A; melatonin receptor 1A; melatonin receptor type 1A; MEL 1A R;
Gene ID 4543
mRNA Refseq NM_005958
Protein Refseq NP_005949
MIM 600665
Uniprot ID P48039
Chromosome Location 4q35
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function melatonin receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTNR1A Products

Required fields are marked with *

My Review for All MTNR1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon