Recombinant Human MTNR1A Protein, GST-tagged

• Cat.No.: MTNR1A-5726H
• Product Overview: Human MTNR1A partial ORF ( NP_005949, 296 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.79 kDa
• AA Sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTNR1A melatonin receptor 1A [ Homo sapiens ]
• Official Symbol: MTNR1A
• Synonyms: MTNR1A; melatonin receptor 1A; melatonin receptor type 1A; MEL 1A R; mel1a receptor; MT1; MEL-1A-R
• Gene ID: 4543
• mRNA Refseq: NM_005958
• Protein Refseq: NP_005949
• MIM: 600665
• UniProt ID: P48039