Recombinant Human MTMR3 Protein, GST-tagged
Cat.No. : | MTMR3-5720H |
Product Overview : | Human MTMR3 partial ORF ( NP_066576.1, 579 a.a. - 674 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.3 kDa |
AA Sequence : | CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTMR3 myotubularin related protein 3 [ Homo sapiens ] |
Official Symbol | MTMR3 |
Synonyms | MTMR3; myotubularin related protein 3; myotubularin-related protein 3; FYVE DSP1; KIAA0371; ZFYVE10; zinc finger, FYVE domain containing 10; zinc finger FYVE domain-containing protein 10; FYVE domain-containing dual specificity protein phosphatase 1; FYVE (Fab1 YGLO23 Vsp27 EEA1 domain) dual-specificity protein phosphatase; FYVE-DSP1; FLJ32333; |
Gene ID | 8897 |
mRNA Refseq | NM_021090 |
Protein Refseq | NP_066576 |
MIM | 603558 |
UniProt ID | Q13615 |
◆ Recombinant Proteins | ||
MTMR3-5720H | Recombinant Human MTMR3 Protein, GST-tagged | +Inquiry |
MTMR3-3814R | Recombinant Rat MTMR3 Protein | +Inquiry |
MTMR3-11113Z | Recombinant Zebrafish MTMR3 | +Inquiry |
MTMR3-3473R | Recombinant Rat MTMR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTMR3-1148HCL | Recombinant Human MTMR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTMR3 Products
Required fields are marked with *
My Review for All MTMR3 Products
Required fields are marked with *
0
Inquiry Basket