Recombinant Human MTL5, GST-tagged

Cat.No. : MTL5-133H
Product Overview : Recombinant Human MTL5(1 a.a. - 306 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 58.7 kDa
AA Sequence : MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADC KGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASH PGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCID NSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPP KITLAG
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTL5 metallothionein-like 5, testis-specific (tesmin) [ Homo sapiens (human) ]
Official Symbol MTL5
Synonyms MTL5; MTLT; CXCDC2; TESMIN; metallothionein-like 5, testis-specific (tesmin); tesmin; CXC domain containing 2; testis-specific metallothionein-like protein
Gene ID 9633
mRNA Refseq NM_001039656
Protein Refseq NP_001034745
MIM 604374
UniProt ID Q9Y4I5
Chromosome Location 11q13.2-q13.3
Function metal ion binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTL5 Products

Required fields are marked with *

My Review for All MTL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon