Recombinant Human MTCH2 Protein, GST-tagged

• Cat.No.: MTCH2-5687H
• Product Overview: Human MTCH2 full-length ORF ( NP_055157.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA can give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon. [provided by RefSeq, Nov 2015]
• Molecular Mass: 59.7 kDa
• AA Sequence: MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTCH2 mitochondrial carrier 2 [ Homo sapiens ]
• Official Symbol: MTCH2
• Synonyms: MTCH2; mitochondrial carrier 2; mitochondrial carrier homolog 2 (C. elegans); mitochondrial carrier homolog 2; SLC25A50; solute carrier family 25; member 50; 2310034D24Rik; met-induced mitochondrial protein; solute carrier family 25, member 50; MIMP; HSPC032
• Gene ID: 23788
• mRNA Refseq: NM_014342
• Protein Refseq: NP_055157
• MIM: 613221
• UniProt ID: Q9Y6C9