Recombinant Human MTA1 protein, GST-tagged
Cat.No. : | MTA1-2455H |
Product Overview : | Human MTA1 full-length ORF ( AAH06177.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 55.1 kDa |
AA Sequence : | MKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGTYLGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED |
Applications : | AP, Array, ELISA, WB-Re |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MTA1 metastasis associated 1 [ Homo sapiens ] |
Official Symbol | MTA1 |
Synonyms | MTA1; metastasis associated 1; metastasis-associated protein MTA1 |
Gene ID | 9112 |
mRNA Refseq | BC006177.1 |
Protein Refseq | AAH06177.1 |
MIM | 603526 |
UniProt ID | Q13330 |
◆ Recombinant Proteins | ||
MTA1-2164C | Recombinant Chicken MTA1 | +Inquiry |
MTA1-2455H | Recombinant Human MTA1 protein, GST-tagged | +Inquiry |
Mta1-2488M | Recombinant Mouse Mta1 protein, His/GST-tagged | +Inquiry |
MTA1-1137HFL | Recombinant Full Length Human MTA1 Protein, C-Flag-tagged | +Inquiry |
MTA1-2459H | Recombinant Human MTA1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTA1-4093HCL | Recombinant Human MTA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTA1 Products
Required fields are marked with *
My Review for All MTA1 Products
Required fields are marked with *
0
Inquiry Basket