Recombinant Human MT-ND1

• Cat.No.: MT-ND1-30257TH
• Product Overview: Recombinant fragment of Human MT-ND1 with N terminal proprietary tag; Predicted MWt 31.24 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 51 amino acids
• Molecular Weight: 31.240kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITLY
• Sequence Similarities: Belongs to the complex I subunit 1 family.

Gene Information

• Gene Name: MT-ND1 mitochondrially encoded NADH dehydrogenase 1 [ Homo sapiens ]
• Official Symbol: MT-ND1
• Synonyms: MT-ND1; mitochondrially encoded NADH dehydrogenase 1; MTND1, NADH dehydrogenase 1; NADH dehydrogenase, subunit 1 (complex I); complex I ND1 subunit; NAD1; NADH ubiquinone oxidoreductase chain 1; ND1
• Gene ID: 4535
• Uniprot ID: P03886
• Chromosome Location: mitochondria
• Pathway: Electron Transport Chain, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NAD/NADH phosphorylation and dephosphorylation, organism-specific biosystem; NADH:ubiquinone oxidoreductase, mitochondria, organism-specific biosystem
• Function: NADH dehydrogenase (ubiquinone) activity; oxidoreductase activity; protein binding