Recombinant Human MSTN protein, His-tagged

Cat.No. : MSTN-3247H
Product Overview : Recombinant Human MSTN protein(O14793)(267-375aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 16.4 kDa
Protein length : 267-375aa
AA Sequence : DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MSTN myostatin [ Homo sapiens ]
Official Symbol MSTN
Synonyms MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP;
Gene ID 2660
mRNA Refseq NM_005259
Protein Refseq NP_005250
MIM 601788
UniProt ID O14793

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MSTN Products

Required fields are marked with *

My Review for All MSTN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon