Recombinant Human MSRB2 Protein, GST-tagged

• Cat.No.: MSRB2-5667H
• Product Overview: Human MSRB2 partial ORF ( NP_036360, 102 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MSRB2 (Methionine Sulfoxide Reductase B2) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Protein repair. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and peptide-methionine (R)-S-oxide reductase activity. An important paralog of this gene is MSRB3.
• Molecular Mass: 36.74 kDa
• AA Sequence: KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSRB2 methionine sulfoxide reductase B2 [ Homo sapiens ]
• Official Symbol: MSRB2
• Synonyms: MSRB2; methionine sulfoxide reductase B2; methionine sulfoxide reductase B , MSRB; methionine-R-sulfoxide reductase B2, mitochondrial; CBS 1; CBS1; CGI 131; PILB; pilin-like transcription factor; MSRB; CBS-1; CGI-131; MGC26104
• Gene ID: 22921
• mRNA Refseq: NM_012228
• Protein Refseq: NP_036360
• MIM: 613782
• UniProt ID: Q9Y3D2