Recombinant Human MSRB2, His-tagged

• Cat.No.: MSRB2-29914TH
• Product Overview: Recombinant full length Human MSRB2 with an N terminal His tag; 183 amino acids with tag, MWt 19.5kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 162 amino acids
• Description: Methionine-R-sulfoxide reductase B2, mitochondrial is an enzyme that in humans is encoded by the MSRB2 gene.
• Conjugation: HIS
• Molecular Weight: 19.500kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH

Gene Information

• Gene Name: MSRB2 methionine sulfoxide reductase B2 [ Homo sapiens ]
• Official Symbol: MSRB2
• Synonyms: MSRB2; methionine sulfoxide reductase B2; methionine sulfoxide reductase B , MSRB; methionine-R-sulfoxide reductase B2, mitochondrial; CBS 1; CBS1; CGI 131; PILB
• Gene ID: 22921
• mRNA Refseq: NM_012228
• Protein Refseq: NP_036360
• MIM: 613782
• Uniprot ID: Q9Y3D2
• Chromosome Location: 10p12
• Function: metal ion binding; oxidoreductase activity; peptide-methionine-(S)-S-oxide reductase activity; protein-methionine-R-oxide reductase activity; sequence-specific DNA binding transcription factor activity