Recombinant Human MSRA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MSRA-4235H |
Product Overview : | MSRA MS Standard C13 and N15-labeled recombinant protein (NP_036463) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MSRA methionine sulfoxide reductase A [ Homo sapiens (human) ] |
Official Symbol | MSRA |
Synonyms | MSRA; methionine sulfoxide reductase A; mitochondrial peptide methionine sulfoxide reductase; peptide Met(O) reductase; peptide met (O) reductase; protein-methionine-S-oxide reductase; peptide methionine sulfoxide reductase; peptide-methionine (S)-S-oxide reductase; cytosolic methionine-S-sulfoxide reductase; PMSR; |
Gene ID | 4482 |
mRNA Refseq | NM_012331 |
Protein Refseq | NP_036463 |
MIM | 601250 |
UniProt ID | Q9UJ68 |
◆ Recombinant Proteins | ||
Msra-462M | Recombinant Mouse Msra Protein, MYC/DDK-tagged | +Inquiry |
MSRA-2407H | Recombinant Human Methionine Sulfoxide Reductase A, His-tagged | +Inquiry |
MSRA-4613H | Recombinant Human MSRA Protein (Ala27-Lys235), N-His tagged | +Inquiry |
MSRA-5665H | Recombinant Human MSRA Protein, GST-tagged | +Inquiry |
MSRA-3453R | Recombinant Rat MSRA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSRA-4109HCL | Recombinant Human MSRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSRA Products
Required fields are marked with *
My Review for All MSRA Products
Required fields are marked with *
0
Inquiry Basket