Recombinant Human MSR1 protein, T7/His-tagged
Cat.No. : | MSR1-44H |
Product Overview : | Recombinant human CD204 extracellular domain cDNA (77 - 451 aa, Isoform II, derived from BC063878) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 77-451 a.a. |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEK RIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLN GKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQG PPGPPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFT KVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGRE SSIEECKIRQWGTRACSHSEDAGVTCTL |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used as coating or soluble factor for in vitro human CD204 mediated macrophage scavenger receptor activities regulation study.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | MSR1 macrophage scavenger receptor 1 [ Homo sapiens ] |
Official Symbol | MSR1 |
Synonyms | MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1; scavenger receptor class A member 1; scavenger receptor class A, member 1; macrophage scavenger receptor type III; macrophage acetylated LDL receptor I and |
Gene ID | 4481 |
mRNA Refseq | NM_138716 |
Protein Refseq | NP_619730 |
MIM | 153622 |
UniProt ID | P21757 |
Chromosome Location | 8p22 |
Pathway | Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; |
Function | low-density lipoprotein particle binding; protein binding; receptor activity; scavenger receptor activity; |
◆ Recombinant Proteins | ||
Msr1-5750M | Recombinant Mouse Msr1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSR1-44H | Recombinant Human MSR1 protein, T7/His-tagged | +Inquiry |
MSR1-4006H | Recombinant Human MSR1 protein, His-tagged | +Inquiry |
MSR1-01H | Active Recombinant Human MSR1 Protein, Fc-tagged | +Inquiry |
RFL30618BF | Recombinant Full Length Bovine Macrophage Scavenger Receptor Types I And Ii(Msr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSR1-800RCL | Recombinant Rat MSR1 cell lysate | +Inquiry |
MSR1-2844HCL | Recombinant Human MSR1 cell lysate | +Inquiry |
MSR1-2288MCL | Recombinant Mouse MSR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSR1 Products
Required fields are marked with *
My Review for All MSR1 Products
Required fields are marked with *
0
Inquiry Basket