Recombinant Human MSR1 protein, T7/His-tagged

Cat.No. : MSR1-44H
Product Overview : Recombinant human CD204 extracellular domain cDNA (77 - 451 aa, Isoform II, derived from BC063878) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His&T7
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEK RIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLN GKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQG PPGPPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFT KVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGRE SSIEECKIRQWGTRACSHSEDAGVTCTL
Purity : >90% by SDS-PAGE
Applications : 1. May be used as coating or soluble factor for in vitro human CD204 mediated macrophage scavenger receptor activities regulation study.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Protein length : 77-451 a.a.
Gene Name MSR1 macrophage scavenger receptor 1 [ Homo sapiens ]
Official Symbol MSR1
Synonyms MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1; scavenger receptor class A member 1; scavenger receptor class A, member 1; macrophage scavenger receptor type III; macrophage acetylated LDL receptor I and
Gene ID 4481
mRNA Refseq NM_138716
Protein Refseq NP_619730
MIM 153622
UniProt ID P21757
Chromosome Location 8p22
Pathway Phagosome, organism-specific biosystem; Phagosome, conserved biosystem;
Function low-density lipoprotein particle binding; protein binding; receptor activity; scavenger receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MSR1 Products

Required fields are marked with *

My Review for All MSR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon