Recombinant Human MSR1 Protein, GST-tagged

• Cat.No.: MSR1-5664H
• Product Overview: Human MSR1 partial ORF ( NP_619729, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimers disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLKERVY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSR1 macrophage scavenger receptor 1 [ Homo sapiens ]
• Official Symbol: MSR1
• Synonyms: MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1; scavenger receptor class A member 1; scavenger receptor class A, member 1; macrophage scavenger receptor type III; macrophage acetylated LDL receptor I and II; SRA; SR-A; phSR1; phSR2
• Gene ID: 4481
• mRNA Refseq: NM_138716
• Protein Refseq: NP_619730
• MIM: 153622
• UniProt ID: P21757