Recombinant Human MSI1 protein, His-tagged
Cat.No. : | MSI1-2441H |
Product Overview : | Recombinant Human MSI1 protein(219-348 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 219-348 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | MSI1 |
Synonyms | MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1; musashi1; musashi-1; |
Gene ID | 4440 |
mRNA Refseq | NM_002442 |
Protein Refseq | NP_002433 |
MIM | 603328 |
UniProt ID | O43347 |
◆ Recombinant Proteins | ||
MSI1-5653H | Recombinant Human MSI1 Protein, GST-tagged | +Inquiry |
MSI1-3789R | Recombinant Rat MSI1 Protein | +Inquiry |
MSI1-2441H | Recombinant Human MSI1 protein, His-tagged | +Inquiry |
MSI1-479H | Recombinant Human MSI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSI1-2184Z | Recombinant Zebrafish MSI1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSI1-4116HCL | Recombinant Human MSI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSI1 Products
Required fields are marked with *
My Review for All MSI1 Products
Required fields are marked with *
0
Inquiry Basket