Recombinant Human MSH6 protein, His-SUMO-tagged

• Cat.No.: MSH6-3246H
• Product Overview: Recombinant Human MSH6 protein(P52701)(1-400aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-400aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 60.1 kDa
• AA Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MSH6 mutS homolog 6 (E. coli) [ Homo sapiens ]
• Official Symbol: MSH6
• Synonyms: MSH6; mutS homolog 6 (E. coli); GTBP, mutS (E. coli) homolog 6; DNA mismatch repair protein Msh6; p160; GTMBP; hMSH6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein; GTBP; HSAP; HNPCC5
• Gene ID: 2956
• mRNA Refseq: NM_000179
• Protein Refseq: NP_000170
• MIM: 600678
• UniProt ID: P52701