Recombinant Human MSANTD1 Protein, GST-tagged

• Cat.No.: MSANTD1-5251H
• Product Overview: Human C4orf44 full-length ORF (BAC86436.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: MSANTD1 (Myb/SANT DNA Binding Domain Containing 1) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.6 kDa
• AA Sequence: MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDGLKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESCDGKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKVQSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREISRCYSTVCRRGCPVAMEWLWTLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSANTD1 Myb/SANT DNA binding domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: MSANTD1
• Synonyms: C4orf44; MSANTD1; Myb/SANT DNA binding domain containing 1; myb/SANT-like DNA-binding domain-containing protein 1; Myb/SANT-like DNA-binding domain containing 1
• Gene ID: 345222
• mRNA Refseq: NM_001042690
• Protein Refseq: NP_001036155
• UniProt ID: Q6ZTZ1