Recombinant Human MS4A8B Protein, GST-tagged

• Cat.No.: MS4A8B-5644H
• Product Overview: Human MS4A8B full-length ORF ( AAH22895, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq
• Molecular Mass: 53.24 kDa
• AA Sequence: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MS4A8B membrane-spanning 4-domains, subfamily A, member 8B [ Homo sapiens ]
• Official Symbol: MS4A8B
• Synonyms: MS4A8B; membrane-spanning 4-domains, subfamily A, member 8B; membrane-spanning 4-domains subfamily A member 8B; MS4A4; four-span transmembrane protein 4; 4SPAN4
• Gene ID: 83661
• mRNA Refseq: NM_031457
• Protein Refseq: NP_113645
• MIM: 606549
• UniProt ID: Q9BY19