Recombinant Human MS4A6E Protein, GST-tagged

• Cat.No.: MS4A6E-5642H
• Product Overview: Human MS4A6E full-length ORF ( NP_640342.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq
• Molecular Mass: 42.3 kDa
• AA Sequence: MTSQPISNETIIMLPSNVINFSQAEKPEPTNQGQDSLKKRLQAKVKVIGVHSSLAGSILSALSALVGFILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASLAGTLSLMLVSTVLEFCLAVLTAVLQWKQTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MS4A6E membrane spanning 4-domains A6E [ Homo sapiens (human) ]
• Official Symbol: MS4A6E
• Synonyms: MS4A6E; membrane spanning 4-domains A6E; membrane-spanning 4-domains subfamily A member 6E; membrane-spanning 4-domains, subfamily A, member 6E
• Gene ID: 245802
• mRNA Refseq: NM_139249
• Protein Refseq: NP_640342
• MIM: 608402
• UniProt ID: Q96DS6