Recombinant Human MS4A6A Protein, GST-tagged

• Cat.No.: MS4A6A-5640H
• Product Overview: Human MS4A6A full-length ORF ( AAH22854, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq
• Molecular Mass: 52.8 kDa
• AA Sequence: MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MS4A6A membrane-spanning 4-domains, subfamily A, member 6A [ Homo sapiens ]
• Official Symbol: MS4A6A
• Synonyms: MS4A6A; membrane-spanning 4-domains, subfamily A, member 6A; MS4A6; membrane-spanning 4-domains subfamily A member 6A; CD20L3; HAIRB-iso; MS4A6A-polymorph; CD20-like precusor; CD20 antigen-like 3; four-span transmembrane protein 3; four-span transmembrane protein 3.1; four-span transmembrane protein 3.2; membrane-spanning 4-domains, subfamily A, member 6A, isoform 2; CDA01; 4SPAN3; MST090; MSTP090; 4SPAN3.2; MGC22650; MGC131944
• Gene ID: 64231
• mRNA Refseq: NM_001247999
• Protein Refseq: NP_001234928
• MIM: 606548
• UniProt ID: Q9H2W1