Recombinant Human MRS2 Protein, GST-tagged

• Cat.No.: MRS2-5630H
• Product Overview: Human MRS2L full-length ORF ( AAH01028, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MRS2 (MRS2, Magnesium Transporter) is a Protein Coding gene. Diseases associated with MRS2 include Basilar Artery Occlusion. Among its related pathways are Miscellaneous transport and binding events and Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds. GO annotations related to this gene include magnesium ion transmembrane transporter activity.
• Molecular Mass: 38.61 kDa
• AA Sequence: MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRS2 MRS2 magnesium homeostasis factor homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: MRS2
• Synonyms: MRS2; MRS2 magnesium homeostasis factor homolog (S. cerevisiae); MRS2 like, magnesium homeostasis factor (S. cerevisiae) , MRS2L; magnesium transporter MRS2 homolog, mitochondrial; MRS2-like protein; MRS2-like, magnesium homeostasis factor; HPT; MRS2L; MGC78523
• Gene ID: 57380
• mRNA Refseq: NM_020662
• Protein Refseq: NP_065713
• UniProt ID: Q9HD23