Recombinant Human MRPS36 Protein, GST-tagged

• Cat.No.: MRPS36-5623H
• Product Overview: Human MRPS36 full-length ORF ( NP_150597.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. The mitochondrial ribosome (mitoribosome) consists of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 3p, 4q, 8p, 11q, 12q, and 20p. [provided by RefSeq
• Molecular Mass: 37.9 kDa
• AA Sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPS36 mitochondrial ribosomal protein S36 [ Homo sapiens ]
• Official Symbol: MRPS36
• Synonyms: MRPS36; mitochondrial ribosomal protein S36; 28S ribosomal protein S36, mitochondrial; DC47; MRP S36; S36mt; MRP-S36; MGC22896
• Gene ID: 92259
• mRNA Refseq: NM_033281
• Protein Refseq: NP_150597
• MIM: 611996
• UniProt ID: P82909