Recombinant Human MRPS23, His-tagged
Cat.No. : | MRPS23-28174TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-190 of Human MRPS23 with N terminal His tag; MWt 30kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-190 a.a. |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 7p. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPP LREPVFQRPRVRYGKAKAPIQDIWYHEDRIRAKFYSVY GSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEK LFVETGKALLAEGVILRRVGEARTQHGGSHVSRKSEHL SVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP |
Full Length : | Full L. |
Gene Name | MRPS23 mitochondrial ribosomal protein S23 [ Homo sapiens ] |
Official Symbol | MRPS23 |
Synonyms | MRPS23; mitochondrial ribosomal protein S23; 28S ribosomal protein S23, mitochondrial; CGI 138; HSPC329; MRP S23; |
Gene ID | 51649 |
mRNA Refseq | NM_016070 |
Protein Refseq | NP_057154 |
MIM | 611985 |
Uniprot ID | Q9Y3D9 |
Chromosome Location | 17q22-q23 |
Function | structural constituent of ribosome; |
◆ Recombinant Proteins | ||
MRPS23-2861R | Recombinant Rhesus monkey MRPS23 Protein, His-tagged | +Inquiry |
MRPS23-2681R | Recombinant Rhesus Macaque MRPS23 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS23-1041Z | Recombinant Zebrafish MRPS23 | +Inquiry |
MRPS23-5612H | Recombinant Human MRPS23 Protein, GST-tagged | +Inquiry |
MRPS23-28174TH | Recombinant Human MRPS23, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS23-4143HCL | Recombinant Human MRPS23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS23 Products
Required fields are marked with *
My Review for All MRPS23 Products
Required fields are marked with *
0
Inquiry Basket