Recombinant Human MRPS23, His-tagged

• Cat.No.: MRPS23-28174TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-190 of Human MRPS23 with N terminal His tag; MWt 30kDa.

Specification

• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 7p.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 89 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPP LREPVFQRPRVRYGKAKAPIQDIWYHEDRIRAKFYSVY GSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEK LFVETGKALLAEGVILRRVGEARTQHGGSHVSRKSEHL SVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP
• Protein length: 1-190 a.a.
• Full Length: Full L.

Gene Information

• Gene Name: MRPS23 mitochondrial ribosomal protein S23 [ Homo sapiens ]
• Official Symbol: MRPS23
• Synonyms: MRPS23; mitochondrial ribosomal protein S23; 28S ribosomal protein S23, mitochondrial; CGI 138; HSPC329; MRP S23
• Gene ID: 51649
• mRNA Refseq: NM_016070
• Protein Refseq: NP_057154
• MIM: 611985
• Uniprot ID: Q9Y3D9
• Chromosome Location: 17q22-q23
• Function: structural constituent of ribosome