Recombinant Human MRPS17 protein, GST-tagged

• Cat.No.: MRPS17-30156H
• Product Overview: Recombinant Human MRPS17 (1-130 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Gln130
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MRPS17 mitochondrial ribosomal protein S17 [ Homo sapiens ]
• Official Symbol: MRPS17
• Synonyms: MRPS17; mitochondrial ribosomal protein S17; 28S ribosomal protein S17, mitochondrial; 28S ribosomal protein S17; mitochondrial; HSPC011; MRP S17; RPMS17; S17mt; MRP-S17
• Gene ID: 51373
• mRNA Refseq: NM_015969
• Protein Refseq: NP_057053
• MIM: 611980
• UniProt ID: Q9Y2R5