Recombinant Human MRPS14 Protein, GST-tagged

• Cat.No.: MRPS14-5602H
• Product Overview: Human MRPS14 full-length ORF ( NP_071383.1, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S14P family. [provided by RefSeq
• Molecular Mass: 41.5 kDa
• AA Sequence: MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPS14 mitochondrial ribosomal protein S14 [ Homo sapiens (human) ]
• Official Symbol: MRPS14
• Synonyms: MRPS14; mitochondrial ribosomal protein S14; S14mt; MRP-S14; HSMRPS14; DJ262D12.2; 28S ribosomal protein S14, mitochondrial; mitochondrial 28S ribosomal protein S14; mitochondrial small ribosomal subunit protein uS14m; EC 3.6.5.3
• Gene ID: 63931
• mRNA Refseq: NM_022100
• Protein Refseq: NP_071383
• MIM: 611978
• UniProt ID: O60783