Recombinant Human MRPL51 Protein, GST-tagged

• Cat.No.: MRPL51-5595H
• Product Overview: Human MRPL51 full-length ORF ( AAH00191, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.82 kDa
• AA Sequence: MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPL51 mitochondrial ribosomal protein L51 [ Homo sapiens ]
• Official Symbol: MRPL51
• Synonyms: MRPL51; mitochondrial ribosomal protein L51; mitochondrial ribosomal protein 64 , MRP64; 39S ribosomal protein L51, mitochondrial; bMRP64; CDA09; HSPC241; L51mt; MRP-L51; bMRP-64; mitochondrial ribosomal protein 64; mitochondrial ribosomal protein bMRP64; MRP64
• Gene ID: 51258
• mRNA Refseq: NM_016497
• Protein Refseq: NP_057581
• MIM: 611855
• UniProt ID: Q4U2R6