Recombinant Human MRPL51 Protein, GST-tagged
Cat.No. : | MRPL51-5595H |
Product Overview : | Human MRPL51 full-length ORF ( AAH00191, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q. [provided by RefSeq |
Molecular Mass : | 39.82 kDa |
AA Sequence : | MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL51 mitochondrial ribosomal protein L51 [ Homo sapiens ] |
Official Symbol | MRPL51 |
Synonyms | MRPL51; mitochondrial ribosomal protein L51; mitochondrial ribosomal protein 64 , MRP64; 39S ribosomal protein L51, mitochondrial; bMRP64; CDA09; HSPC241; L51mt; MRP-L51; bMRP-64; mitochondrial ribosomal protein 64; mitochondrial ribosomal protein bMRP64; MRP64; |
Gene ID | 51258 |
mRNA Refseq | NM_016497 |
Protein Refseq | NP_057581 |
MIM | 611855 |
UniProt ID | Q4U2R6 |
◆ Recombinant Proteins | ||
MRPL51-6442HF | Recombinant Full Length Human MRPL51 Protein, GST-tagged | +Inquiry |
MRPL51-1860C | Recombinant Chicken MRPL51 | +Inquiry |
MRPL51-2670R | Recombinant Rhesus Macaque MRPL51 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL51-5595H | Recombinant Human MRPL51 Protein, GST-tagged | +Inquiry |
MRPL51-2850R | Recombinant Rhesus monkey MRPL51 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL51-4158HCL | Recombinant Human MRPL51 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL51 Products
Required fields are marked with *
My Review for All MRPL51 Products
Required fields are marked with *
0
Inquiry Basket