Recombinant Human MRPL38 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MRPL38-5895H
• Product Overview: MRPL38 MS Standard C13 and N15-labeled recombinant protein (NP_115867) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 44.4 kDa
• AA Sequence: MPNSDIDLSNLERLEKYRSFDRYRRRAEQEAQAPHWWRTYREYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRLAEYYGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAEGQVTCPYLPPFPARGSGIHRLAFLLFKQDQPIDFSEDARPSPCYQLAQRTFRTFDFYKKHQETMTPAGLSFFQCRWDDSVTYIFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYGIYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MRPL38 mitochondrial ribosomal protein L38 [ Homo sapiens (human) ]
• Official Symbol: MRPL38
• Synonyms: MRPL38; mitochondrial ribosomal protein L38; 39S ribosomal protein L38, mitochondrial; HSPC262; MGC4810; MRP L3; RPML3; L38MT; MRP-L3; MRP-L38; FLJ13996; KIAA1863
• Gene ID: 64978
• mRNA Refseq: NM_032478
• Protein Refseq: NP_115867
• MIM: 611844
• UniProt ID: Q96DV4