Recombinant Human MRPL38 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MRPL38-5895H |
Product Overview : | MRPL38 MS Standard C13 and N15-labeled recombinant protein (NP_115867) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. |
Molecular Mass : | 44.4 kDa |
AA Sequence : | MPNSDIDLSNLERLEKYRSFDRYRRRAEQEAQAPHWWRTYREYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRLAEYYGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAEGQVTCPYLPPFPARGSGIHRLAFLLFKQDQPIDFSEDARPSPCYQLAQRTFRTFDFYKKHQETMTPAGLSFFQCRWDDSVTYIFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYGIYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MRPL38 mitochondrial ribosomal protein L38 [ Homo sapiens (human) ] |
Official Symbol | MRPL38 |
Synonyms | MRPL38; mitochondrial ribosomal protein L38; 39S ribosomal protein L38, mitochondrial; HSPC262; MGC4810; MRP L3; RPML3; L38MT; MRP-L3; MRP-L38; FLJ13996; KIAA1863; |
Gene ID | 64978 |
mRNA Refseq | NM_032478 |
Protein Refseq | NP_115867 |
MIM | 611844 |
UniProt ID | Q96DV4 |
◆ Recombinant Proteins | ||
MRPL38-6398HF | Recombinant Full Length Human MRPL38 Protein, GST-tagged | +Inquiry |
Mrpl38-4155M | Recombinant Mouse Mrpl38 Protein, Myc/DDK-tagged | +Inquiry |
MRPL38-5895H | Recombinant Human MRPL38 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MRPL38-5581H | Recombinant Human MRPL38 Protein, GST-tagged | +Inquiry |
MRPL38-1002H | Recombinant Human MRPL38, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL38-4174HCL | Recombinant Human MRPL38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL38 Products
Required fields are marked with *
My Review for All MRPL38 Products
Required fields are marked with *
0
Inquiry Basket