Recombinant Human MRPL32 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MRPL32-2259H
• Product Overview: MRPL32 MS Standard C13 and N15-labeled recombinant protein (NP_114109) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L32 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome Xp.
• Molecular Mass: 21.4 kDa
• AA Sequence: MALAMLVLVVSPWSAARGVLRNYWERLLRKLPQSRPGFPSPPWGPALAVQGPAMFTEPANDTSGSKENSSLLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYEKVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRIIERDRKRPSWFTQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MRPL32 mitochondrial ribosomal protein L32 [ Homo sapiens (human) ]
• Official Symbol: MRPL32
• Synonyms: MRPL32; mitochondrial ribosomal protein L32; L32mt; HSPC283; MRP-L32; bMRP-59b; 39S ribosomal protein L32, mitochondrial; mitochondrial large ribosomal subunit protein bL32m; EC 3.6.5.3
• Gene ID: 64983
• mRNA Refseq: NM_031903
• Protein Refseq: NP_114109
• MIM: 611839
• UniProt ID: Q9BYC8