Recombinant Human MRPL23 Protein, GST-tagged

Cat.No. : MRPL23-5568H
Product Overview : Human MRPL23 full-length ORF ( AAH27710, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. The gene is biallelically expressed, despite its location within a region of imprinted genes on chromosome 11. [provided by RefSeq
Molecular Mass : 42.68 kDa
AA Sequence : MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPL23 mitochondrial ribosomal protein L23 [ Homo sapiens ]
Official Symbol MRPL23
Synonyms MRPL23; mitochondrial ribosomal protein L23; RPL23L; 39S ribosomal protein L23, mitochondrial; L23MRP; L23mt; MRP-L23; L23 mitochondrial-related protein; ribosomal protein related to L23 (mitochondrial); RPL23; FLJ45387;
Gene ID 6150
mRNA Refseq NM_021134
Protein Refseq NP_066957
MIM 600789
UniProt ID Q16540

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MRPL23 Products

Required fields are marked with *

My Review for All MRPL23 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon