Recombinant Human MRPL11 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MRPL11-5000H
• Product Overview: MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12.
• Molecular Mass: 18 kDa
• AA Sequence: MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MRPL11 mitochondrial ribosomal protein L11 [ Homo sapiens (human) ]
• Official Symbol: MRPL11
• Synonyms: MRPL11; mitochondrial ribosomal protein L11; 39S ribosomal protein L11, mitochondrial; L11MT; CGI-113; MRP-L11; MGC111024
• Gene ID: 65003
• mRNA Refseq: NM_170738
• Protein Refseq: NP_733934
• MIM: 611826
• UniProt ID: Q9Y3B7