Recombinant Human MRGPRD Protein, GST-tagged

• Cat.No.: MRGPRD-5541H
• Product Overview: Human MRGPRD full-length ORF ( NP_944605.2, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MRGPRD (MAS Related GPR Family Member D) is a Protein Coding gene. Among its related pathways are ACE Inhibitor Pathway, Pharmacodynamics. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is MRGPRX4.
• Molecular Mass: 62.5 kDa
• AA Sequence: MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRGPRD MAS-related GPR, member D [ Homo sapiens ]
• Official Symbol: MRGPRD
• Synonyms: MRGPRD; MAS-related GPR, member D; mas-related G-protein coupled receptor member D; mrgD; beta-alanine receptor; G-protein coupled receptor TGR7; mas-related G protein-coupled MRGD; MRGD; TGR7
• Gene ID: 116512
• mRNA Refseq: NM_198923
• Protein Refseq: NP_944605
• MIM: 607231
• UniProt ID: Q8TDS7