Recombinant Human MRE11A protein, His-tagged

• Cat.No.: MRE11A-2895H
• Product Overview: Recombinant Human MRE11A protein(170-400 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 170-400 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MRE11A MRE11 meiotic recombination 11 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: MRE11A
• Synonyms: MRE11A; MRE11 meiotic recombination 11 homolog A (S. cerevisiae); meiotic recombination (S. cerevisiae) 11 homolog A , MRE11; double-strand break repair protein MRE11A; AT like disease; ATLD; AT-like disease; MRE11 homolog 1; MRE11 homolog A; endo/exonuclease Mre11; meiotic recombination 11 homolog 1; meiotic recombination 11 homolog A; DNA recombination and repair protein; HNGS1; MRE11; MRE11B
• Gene ID: 4361
• mRNA Refseq: NM_005590
• Protein Refseq: NP_005581
• MIM: 600814
• UniProt ID: P49959