Recombinant Human MR1 Protein, GST-tagged

• Cat.No.: MR1-5529H
• Product Overview: Human MR1 partial ORF ( NP_001522, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MAIT (mucosal-associated invariant T-cells) lymphocytes represent a small population of T-cells primarily found in the gut. The protein encoded by this gene is an antigen-presenting molecule that presents metabolites of microbial vitamin B to MAITs. This presentation may activate the MAITs to regulate the amounts of specific types of bacteria in the gut. Several transcript variants encoding different isoforms have been found for this gene, and a pseudogene of it has been detected about 36 kbp upstream on the same chromosome. [provided by RefSeq, Jul 2015]
• Molecular Mass: 36.74 kDa
• AA Sequence: TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MR1 major histocompatibility complex, class I-related [ Homo sapiens ]
• Official Symbol: MR1
• Synonyms: MR1; major histocompatibility complex, class I-related; HLALS, major histocompatibility complex, class I like sequence; major histocompatibility complex class I-related gene protein; MHC class I-like antigen MR-1; MHC class I-related gene protein; MHC class-I related-gene protein; class I histocompatibility antigen-like protein; major histocompatibility complex, class I-like sequence; HLALS; FLJ31593
• Gene ID: 3140
• mRNA Refseq: NM_001194999
• Protein Refseq: NP_001181928
• MIM: 600764
• UniProt ID: Q95460