Recombinant Human MPZL1 Protein, GST-tagged

Cat.No. : MPZL1-5525H
Product Overview : Human MPZL1 full-length ORF ( AAH07881, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MPZL1 (Myelin Protein Zero Like 1) is a Protein Coding gene. Diseases associated with MPZL1 include Noonan Syndrome 1. Among its related pathways are Cell adhesion molecules (CAMs) and Tyrosine Kinases / Adaptors. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is MPZ.
Molecular Mass : 55.33 kDa
AA Sequence : MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPZL1 myelin protein zero-like 1 [ Homo sapiens ]
Official Symbol MPZL1
Synonyms MPZL1; myelin protein zero-like 1; myelin protein zero-like protein 1; FLJ21047; PZR; protein zero related; protein zero-related; immunoglobulin family transmembrane protein; PZRa; PZRb; PZR1b; MPZL1b;
Gene ID 9019
mRNA Refseq NM_001146191
Protein Refseq NP_001139663
MIM 604376
UniProt ID O95297

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MPZL1 Products

Required fields are marked with *

My Review for All MPZL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon