Recombinant Human MPPED2 Protein, GST-tagged

• Cat.No.: MPPED2-5519H
• Product Overview: Human MPPED2 full-length ORF ( AAH31582, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq
• Molecular Mass: 58.08 kDa
• AA Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPPED2 metallophosphoesterase domain containing 2 [ Homo sapiens ]
• Official Symbol: MPPED2
• Synonyms: MPPED2; metallophosphoesterase domain containing 2; C11orf8, chromosome 11 open reading frame 8; metallophosphoesterase MPPED2; 239FB; D11S302E; dJ873F21.1; dJ1024C24.1; FAM1B; Hs.46638; fetal brain protein 239; metallophosphoesterase domain-containing protein 2; C11orf8
• Gene ID: 744
• mRNA Refseq: NM_001145399
• Protein Refseq: NP_001138871
• MIM: 600911
• UniProt ID: Q15777