Recombinant Human MPPED2 Protein, GST-tagged
Cat.No. : | MPPED2-5519H |
Product Overview : | Human MPPED2 full-length ORF ( AAH31582, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq |
Molecular Mass : | 58.08 kDa |
AA Sequence : | MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPPED2 metallophosphoesterase domain containing 2 [ Homo sapiens ] |
Official Symbol | MPPED2 |
Synonyms | MPPED2; metallophosphoesterase domain containing 2; C11orf8, chromosome 11 open reading frame 8; metallophosphoesterase MPPED2; 239FB; D11S302E; dJ873F21.1; dJ1024C24.1; FAM1B; Hs.46638; fetal brain protein 239; metallophosphoesterase domain-containing protein 2; C11orf8; |
Gene ID | 744 |
mRNA Refseq | NM_001145399 |
Protein Refseq | NP_001138871 |
MIM | 600911 |
UniProt ID | Q15777 |
◆ Recombinant Proteins | ||
MPPED2-6333HF | Recombinant Full Length Human MPPED2 Protein, GST-tagged | +Inquiry |
MPPED2-3739R | Recombinant Rat MPPED2 Protein | +Inquiry |
MPPED2-5519H | Recombinant Human MPPED2 Protein, GST-tagged | +Inquiry |
MPPED2-2636R | Recombinant Rhesus Macaque MPPED2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mpped2-4128M | Recombinant Mouse Mpped2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPPED2-4226HCL | Recombinant Human MPPED2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPPED2 Products
Required fields are marked with *
My Review for All MPPED2 Products
Required fields are marked with *
0
Inquiry Basket