Recombinant Human MPPED1 Protein, GST-tagged

• Cat.No.: MPPED1-5518H
• Product Overview: Human MPPED1 partial ORF ( NP_001576, 34 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MPPED1 (Metallophosphoesterase Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is MPPED2.
• Molecular Mass: 35.64 kDa
• AA Sequence: AARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPPED1 metallophosphoesterase domain containing 1 [ Homo sapiens ]
• Official Symbol: MPPED1
• Synonyms: MPPED1; metallophosphoesterase domain containing 1; C22orf1, chromosome 22 open reading frame 1; metallophosphoesterase domain-containing protein 1; 239AB; FAM1A; adult brain protein 239; C22orf1; FLJ50009; FLJ54633; FLJ59965; FLJ78907; MGC88045
• Gene ID: 758
• mRNA Refseq: NM_001044370
• Protein Refseq: NP_001037835
• MIM: 602112
• UniProt ID: O15442