Recombinant Human MPP3, His-tagged
Cat.No. : | MPP3-30040TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 174-585 of Human MPP3 with an N terminal His tag; Predicted MWt 58 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 174-585 a.a. |
Description : | This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. This protein contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction. Alternatively spliced transcript variants have been identified. One transcript variant is experimentally supported, but it doesnt encode a protein. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 157 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLK IIPATQEEDRLKESKVFMRALFHYNPREDRAIPCQEAG LPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSK GFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDC EGYLKGHYVAGLRRSFRLGCRERLGGSQEGKMSSGAESPE LLTYEEVARYQHQPGERPRLVVLIGSLGARLHELKQKV VAENPQHFGVAVPHTTRPRKSHEKEGVEYHFVSKQAFE ADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLV DVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPA CEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQ GAYSQLKVVLEKLSKDTHWVPVSWVR |
Sequence Similarities : | Belongs to the MAGUK family.Contains 1 guanylate kinase-like domain.Contains 2 L27 domains.Contains 1 PDZ (DHR) domain.Contains 1 SH3 domain. |
Gene Name | MPP3 membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) [ Homo sapiens ] |
Official Symbol | MPP3 |
Synonyms | MPP3; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3); DLG3; MAGUK p55 subfamily member 3; discs; large (Drosophila) homolog 3; membrane protein palmitoylated 3; |
Gene ID | 4356 |
mRNA Refseq | NM_001932 |
Protein Refseq | NP_001923 |
MIM | 601114 |
Uniprot ID | Q13368 |
Chromosome Location | 17q12-q21 |
Function | PDZ domain binding; guanylate kinase activity; |
◆ Recombinant Proteins | ||
RFL27762RF | Recombinant Full Length Rat Integral Membrane Protein 2C(Itm2C) Protein, His-Tagged | +Inquiry |
BOLA2-1067M | Recombinant Mouse BOLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIC-2153H | Recombinant Human PPIC Protein (Lys31-Asp182), N-Trx and His tagged | +Inquiry |
RPN2-01H | Recombinant Human RPN1 Protein, Myc/DDK-tagged | +Inquiry |
NRN1-10896M | Recombinant Mouse NRN1 Protein | +Inquiry |
◆ Native Proteins | ||
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF784-10HCL | Recombinant Human ZNF784 293 Cell Lysate | +Inquiry |
DNAJB8-494HCL | Recombinant Human DNAJB8 cell lysate | +Inquiry |
COX5A-389HCL | Recombinant Human COX5A cell lysate | +Inquiry |
NUDCD3-3657HCL | Recombinant Human NUDCD3 293 Cell Lysate | +Inquiry |
MTMR6-1150HCL | Recombinant Human MTMR6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPP3 Products
Required fields are marked with *
My Review for All MPP3 Products
Required fields are marked with *
0
Inquiry Basket