Recombinant Human MPP1, His-tagged
Cat.No. : | MPP1-29357TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 32-466 of Human MPP1 with N terminal His tag; 435 amino acids, 56kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 32-466 a.a. |
Description : | This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 90 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRL IQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQG SLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFA TGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQE WRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALL SQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTR NISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDS EAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSP QWVPVSWVY |
Sequence Similarities : | Belongs to the MAGUK family.Contains 1 guanylate kinase-like domain.Contains 1 PDZ (DHR) domain.Contains 1 SH3 domain. |
Gene Name | MPP1 membrane protein, palmitoylated 1, 55kDa [ Homo sapiens ] |
Official Symbol | MPP1 |
Synonyms | MPP1; membrane protein, palmitoylated 1, 55kDa; DXS552E, membrane protein, palmitoylated 1 (55kD); 55 kDa erythrocyte membrane protein; PEMP; |
Gene ID | 4354 |
mRNA Refseq | NM_001166460 |
Protein Refseq | NP_001159932 |
MIM | 305360 |
Uniprot ID | Q00013 |
Chromosome Location | Xq28 |
Function | guanylate kinase activity; protein binding; |
◆ Recombinant Proteins | ||
MPP1-9991M | Recombinant Mouse MPP1 Protein | +Inquiry |
MPP1-5507H | Recombinant Human MPP1 Protein, GST-tagged | +Inquiry |
MPP1-1796C | Recombinant Chicken MPP1 | +Inquiry |
MPP1-6326HF | Recombinant Full Length Human MPP1 Protein, GST-tagged | +Inquiry |
MPP1-5652M | Recombinant Mouse MPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPP1-4233HCL | Recombinant Human MPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPP1 Products
Required fields are marked with *
My Review for All MPP1 Products
Required fields are marked with *
0
Inquiry Basket