Recombinant Human MPP1, His-tagged
Cat.No. : | MPP1-29357TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 32-466 of Human MPP1 with N terminal His tag; 435 amino acids, 56kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 32-466 a.a. |
Description : | This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 90 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRL IQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQG SLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFA TGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQE WRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALL SQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTR NISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDS EAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSP QWVPVSWVY |
Sequence Similarities : | Belongs to the MAGUK family.Contains 1 guanylate kinase-like domain.Contains 1 PDZ (DHR) domain.Contains 1 SH3 domain. |
Gene Name | MPP1 membrane protein, palmitoylated 1, 55kDa [ Homo sapiens ] |
Official Symbol | MPP1 |
Synonyms | MPP1; membrane protein, palmitoylated 1, 55kDa; DXS552E, membrane protein, palmitoylated 1 (55kD); 55 kDa erythrocyte membrane protein; PEMP; |
Gene ID | 4354 |
mRNA Refseq | NM_001166460 |
Protein Refseq | NP_001159932 |
MIM | 305360 |
Uniprot ID | Q00013 |
Chromosome Location | Xq28 |
Function | guanylate kinase activity; protein binding; |
◆ Native Proteins | ||
Egf -635R | Native Rat Egf protein | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2A1-59HCL | Recombinant Human BCL2A1 lysate | +Inquiry |
GPR31-5788HCL | Recombinant Human GPR31 293 Cell Lysate | +Inquiry |
HRASLS-816HCL | Recombinant Human HRASLS cell lysate | +Inquiry |
PKNOX1-3148HCL | Recombinant Human PKNOX1 293 Cell Lysate | +Inquiry |
FAM107A-581HCL | Recombinant Human FAM107A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MPP1 Products
Required fields are marked with *
My Review for All MPP1 Products
Required fields are marked with *
0
Inquiry Basket