Recombinant Human MOXD1 protein, GST-tagged

• Cat.No.: MOXD1-98H
• Product Overview: Recombinant MOXD1 protein(21a.a.-120a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by using Glutathione Sepharose 4 Fast Flow.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 100
• Description: DBH-like 1 maintains many of the structural features of dopamine beta-monooxygenase DBH. Since Peptidylglycine alpha-hydroxylating monooxygenase is homologous to dopamine beta-monooxygenase this concerns a structural basis for a new family of copper type II, significantly specific for ascorbate-dependent monooxygenases based on the corresponding mouse homolog. The pathway of catecholamine synthesis is a possible catecholamine-binding metabolic copper enzyme domain, a neuron-like property encoding MOX without a signal sequence enzyme metabolism resolving the monooxygenase X chemical pathway of an unknown substrate, exogenous MOX is not secreted, and it localizes throughout the endoplasmic reticulum, in both endocrine or nonendocrine cells.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: DYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFD
• Applications: AP, Array, ELISA, WB-Re
• Storage: Store at -80 centigrade. Aliquot to avoidrepeated freezing and thawing.

Gene Information

• Gene Name: MOXD1
• Official Symbol: MOXD1
• Synonyms: DKFZp564G202; MOX; PRO5780; dJ248E1.1
• Gene ID: 26002
• mRNA Refseq: NM_015529.4
• Protein Refseq: NP_056344.2
• MIM: 609000
• UniProt ID: Q6UVY6