Recombinant Human MOV10L1 Protein, GST-tagged

• Cat.No.: MOV10L1-5491H
• Product Overview: Human MOV10L1 partial ORF ( NP_061868, 436 a.a. - 545 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: FLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOV10L1 Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse) [ Homo sapiens ]
• Official Symbol: MOV10L1
• Synonyms: CHAMP; DJ402G11.8
• Gene ID: 54456
• mRNA Refseq: NM_018995
• Protein Refseq: NP_061868
• MIM: 605794
• UniProt ID: Q9BXT6