Recombinant Human MOSC1 Protein, His-tagged

• Cat.No.: MOSC1-36H
• Product Overview: Recombinant Human MOSC1 Protein(NP_073583.3)(Arg41~Leu335) is expressed from E. coli with a His Tag at the N-terminal.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Arg41~Leu335
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT,0.01% SKL, 5% Trehalose and Proclin300.
• Molecular Mass: 37kDa(Analysis of differences refer to the manual)
• AA Sequence: RRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLL
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 97%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB. (May be suitable for use in other assays to be determined by the end user.)
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles.
  Store at 2-8°C for one month.
  Aliquot and store at -80ºC for 12 months.
• Concentration: 200µg/mL
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: MTARC1
• Official Symbol: MTARC1
• Synonyms: Molybdenum Cofactor Sulphurase C-Terminal Domain Containing Protein; Mitochondrial amidoxime-reducing component 1
• Gene ID: 64757
• mRNA Refseq: NM_022746.4
• Protein Refseq: NP_073583.3
• MIM: 614126
• UniProt ID: Q5VT66