Recombinant Human MORN5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MORN5-4299H
• Product Overview: MORN5 MS Standard C13 and N15-labeled recombinant protein (NP_940871) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: MORN5 (MORN Repeat Containing 5) is a Protein Coding gene.
• Molecular Mass: 18.7 kDa
• AA Sequence: MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MORN5 MORN repeat containing 5 [ Homo sapiens (human) ]
• Official Symbol: MORN5
• Synonyms: MORN5; MORN repeat containing 5; C9orf18; C9orf113; MORN repeat-containing protein 5
• Gene ID: 254956
• mRNA Refseq: NM_198469
• Protein Refseq: NP_940871
• UniProt ID: Q5VZ52