Recombinant Human MORF4L2, His-tagged

• Cat.No.: MORF4L2-29353TH
• Product Overview: Recombinant full length Human Mortality Factor 4 like 2 with an N terminal His tag; 308 amino acids with the tag, predicted MWt: 34.4 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 288 amino acids
• Description: Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A.
• Conjugation: HIS
• Molecular Weight: 34.400kDa
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
• Sequence Similarities: Belongs to the MRG family.

Gene Information

• Gene Name: MORF4L2 mortality factor 4 like 2 [ Homo sapiens ]
• Official Symbol: MORF4L2
• Synonyms: MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX
• Gene ID: 9643
• mRNA Refseq: NM_001142425
• Protein Refseq: NP_001135897
• MIM: 300409
• Uniprot ID: Q15014
• Chromosome Location: Xq22
• Function: protein binding