Recombinant Human MORF4L2, His-tagged

Cat.No. : MORF4L2-29353TH
Product Overview : Recombinant full length Human Mortality Factor 4 like 2 with an N terminal His tag; 308 amino acids with the tag, predicted MWt: 34.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 288 amino acids
Description : Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A.
Conjugation : HIS
Molecular Weight : 34.400kDa
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
Sequence Similarities : Belongs to the MRG family.
Gene Name MORF4L2 mortality factor 4 like 2 [ Homo sapiens ]
Official Symbol MORF4L2
Synonyms MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX;
Gene ID 9643
mRNA Refseq NM_001142425
Protein Refseq NP_001135897
MIM 300409
Uniprot ID Q15014
Chromosome Location Xq22
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MORF4L2 Products

Required fields are marked with *

My Review for All MORF4L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon